PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 340aa    MW: 38319.3 Da    PI: 6.5148
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19359.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.61.9e-101460147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg WTteEd + +    ++G+g+W++++++  ++R++ +c+ rw +y
       KHN19359.1 14 RGLWTTEEDTKKLAFGSKHGSGNWTSVPKKSRLKRCGRSCRIRWTNY 60
                     788******************************************99 PP

2Myb_DNA-binding43.47.6e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++Tt+E++l++++++  G++ W+ Ia+ ++ gRt+ ++k++w++
       KHN19359.1  68 DNFTTQEEDLIIKLHAAIGSR-WSIIAQQLP-GRTDTDVKNYWNS 110
                      589******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.191961IPR017930Myb domain
SuperFamilySSF466892.05E-2411108IPR009057Homeodomain-like
SMARTSM007171.2E-51363IPR001005SANT/Myb domain
PfamPF002492.1E-81460IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-151568IPR009057Homeodomain-like
CDDcd001672.64E-51760No hitNo description
PROSITE profilePS5129420.81762116IPR017930Myb domain
SMARTSM007173.6E-1266114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-2269116IPR009057Homeodomain-like
PfamPF002492.8E-1269110IPR001005SANT/Myb domain
CDDcd001672.28E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MARSPSCEKI NVKRGLWTTE EDTKKLAFGS KHGSGNWTSV PKKSRLKRCG RSCRIRWTNY  60
PRPDLKDDNF TTQEEDLIIK LHAAIGSRWS IIAQQLPGRT DTDVKNYWNS KLKKKLSQLG  120
IDPVTHKPFS KLIADYGNIG GCQKPSTRIA SINKDFKNAM MLKSESHQTL PEGFITNIND  180
QPKPPPKMET TGNNFLFNRT HGDDLLMNLD QFQAISMKSG ASNCIDFENE IMSVSMFGED  240
CFSKTSSPST PSTCSTTAFS WNDFLLEDAF TPLANQEQDL VSQIEDLTWN KIEVKSLQAS  300
GSDLQFSSAS DISFMEAMLD QENEMFLSFP HLMEEPSKLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-81AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581947.10.0PREDICTED: transcription factor MYB35-like
TrEMBLA0A0B2QGM50.0A0A0B2QGM5_GLYSO; Myb-related protein Zm38
STRINGGLYMA06G20020.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-66MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]